PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00911g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 348aa    MW: 39335.6 Da    PI: 8.7357
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00911g00012.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.3e-171461148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT+eEd++l  +++++G g+W++ +++ g++R++k+c++rw +yl
  Peaxi162Scf00911g00012.1 14 KGPWTPEEDQKLMACIEKHGCGSWRALPAKAGLKRCGKSCRLRWINYL 61
                              79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129423.868965IPR017930Myb domain
SuperFamilySSF466891.76E-231197IPR009057Homeodomain-like
SMARTSM007175.1E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001671.87E-101661No hitNo description
Gene3DG3DSA:1.10.10.602.1E-1265105IPR009057Homeodomain-like
PROSITE profilePS512948.51366105IPR017930Myb domain
SMARTSM007170.00166103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRSPCCEKL GLKKGPWTPE EDQKLMACIE KHGCGSWRAL PAKAGLKRCG KSCRLRWINY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRTD NEIKNYWNTH LRKRLTKMGI DPITHKPKTN  120
IFGSSQLSHM AQWENARLEA EARLVRESKK QISNNNIHDF GSLANTRLAH HQLFNQRSRI  180
NNIVPLQAKV PPFLDVLKVW QDSNWTKPKI TKDTSSSSVL DSVLTSMNNG SFDSPTSTNN  240
LFMAPNNNIP RLVDNSCLVN AGSFMENPEV EIITKEEVQT DQVQINDISS INYMSITDQS  300
SGFPSFIQGF THLENIVGSS EDNLEDNKYS YWNTILNSCT SPAGSPVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-20121055108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591172.11e-161PREDICTED: transcription factor MYB39-like
RefseqXP_016468968.11e-161PREDICTED: transcription factor MYB39-like
TrEMBLM1C9301e-127M1C930_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000624371e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.15e-87myb domain protein 16